PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bostr.9638s0035.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Boechereae; Boechera
Family LBD
Protein Properties Length: 214aa    MW: 24166.5 Da    PI: 6.3872
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bostr.9638s0035.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260102.24.6e-3251041100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +C+aCkv++ +C ++C+lap+fp ++ ++f+ +h++FG++nv+k+l +l+  +r++a+++l+y+A+ar rdP+ G vg++ ++q+ql+ l
  Bostr.9638s0035.1.p   5 RCSACKVMKCDCDPGCILAPHFPLTNLESFERLHRIFGVENVCKILVNLESPQRKIAIRALCYKADARERDPIFGYVGMFDHYQHQLKIL 94 
                          6***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          +++ +++k+e
  Bostr.9638s0035.1.p  95 EEQFNSAKNE 104
                          ****999987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089121.964105IPR004883Lateral organ boundaries, LOB
PfamPF031955.3E-295102IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 214 aa     Download sequence    Send to blast
MNSNRCSACK VMKCDCDPGC ILAPHFPLTN LESFERLHRI FGVENVCKIL VNLESPQRKI  60
AIRALCYKAD ARERDPIFGY VGMFDHYQHQ LKILEEQFNS AKNELVTIIG PDKVPQYSSH  120
PMPYDFLTTN SSLQSYIEKM EGLNEVQKNE LMQLPIADTP RILNERFRKK EDEKMCDGHG  180
DAGASTSIVS SMACERTSAT HETLPSPQNQ NQP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_198439.13e-97LOB domain-containing protein 35
SwissprotQ9FFL34e-99LBD35_ARATH; LOB domain-containing protein 35
TrEMBLD7KJB32e-56D7KJB3_ARALL; Putative uncharacterized protein
TrEMBLD7ME152e-56D7ME15_ARALL; Putative uncharacterized protein
STRINGAT5G35900.11e-96(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM45251455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G35900.11e-100LOB domain-containing protein 35